PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0051s00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 527aa    MW: 58840 Da    PI: 5.2444
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0051s00070.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.8e-164188148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+ Ed +l+++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Vradi0051s00070.1 41 KGPWTAGEDAILLEYVNKHGQGNWNAVQKYSGLARCGKSCRLRWANHL 88
                       79******************************************9986 PP

2Myb_DNA-binding48.91.5e-1594137146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        +g++T+eE+ ++++++++lG++ W++ a++++ g t++++k++w++
  Vradi0051s00070.1  94 KGAFTQEEENRILELHAKLGNK-WARMASELP-GHTDNEIKNYWNT 137
                        799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3233688IPR017930Myb domain
SuperFamilySSF466897.11E-2938135IPR009057Homeodomain-like
SMARTSM007171.1E-134090IPR001005SANT/Myb domain
PfamPF002492.6E-154188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-234295IPR009057Homeodomain-like
CDDcd001675.29E-114388No hitNo description
PROSITE profilePS5129424.25689143IPR017930Myb domain
SMARTSM007177.1E-1593141IPR001005SANT/Myb domain
PfamPF002491.9E-1494137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2396141IPR009057Homeodomain-like
CDDcd001671.30E-1096137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MSSVTNGDDD QKIYRGRSSS LHEEAHVGGN TGGEGEVPLK KGPWTAGEDA ILLEYVNKHG  60
QGNWNAVQKY SGLARCGKSC RLRWANHLRP DLKKGAFTQE EENRILELHA KLGNKWARMA  120
SELPGHTDNE IKNYWNTRIK RMQRAGLPIY PPEICERILN GNQESKNIDP LNIEASQHDN  180
LSQMDKFGIP DMDLKTVKFH HDPSQVPRIF EMPENLFEQS SDSSYLFPTI YPSKRRRESE  240
TLYNSFTSCT SNALPLFDQY DNYTSEKTYD HPRFYPPFGP VLNSSNQFHG GNINGSHAML  300
NGNVSSSVPF FGARKLELPS LQYTETQHGS WITNGSPLPS LESVDTMIQS PPVESIPSDL  360
ISLQSSGLLE AIVYNQKSMK NSNTDLFLPM ITGTSNEAAG SSTLNNPYKT EWDEQGELNS  420
PLGQSAASVM TDYTPISSVD GPQSIETTQD HDDKLQALTW VPNSSRKKRK SEQIDFSQRP  480
DALFDLAWFG NNNDYGISQS DLKDALSALL GEDYNDNFGE HSKGKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29391415106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014524479.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_014524480.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A0S3S7A00.0A0A0S3S7A0_PHAAN; Uncharacterized protein
STRINGGLYMA20G11040.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.36e-92myb domain protein 33